PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G05160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family CO-like
Protein Properties Length: 348aa    MW: 35710.1 Da    PI: 6.8954
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G05160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.51.1e-0756101342
         zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                       ++C+ +e  ++   C+ +   lC+ C   +H+       H++vp+
  LPERR02G05160.1  56 VWVCEVCELSPAAVTCKADAAALCAACDADIHHAnplarrHERVPV 101
                      689*****999********************645599999999986 PP

2CCT69.58.5e-24274317144
              CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                      R+a+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k+a
  LPERR02G05160.1 274 RAARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRA 317
                      99****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0281158IPR000315B-box-type zinc finger
PROSITE profilePS5011911.30554101IPR000315B-box-type zinc finger
PfamPF006438.6E-655101IPR000315B-box-type zinc finger
SMARTSM003369.4E-859101IPR000315B-box-type zinc finger
PfamPF062031.0E-17274316IPR010402CCT domain
PROSITE profilePS5101716.807274316IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MELGLGRYWG VGGRRCGACA VAPAAVHCRT CGGGGGGGYL CAACDADHAR AGHERVWVCE  60
VCELSPAAVT CKADAAALCA ACDADIHHAN PLARRHERVP VQPIGSAAAT DADALLFGGE  120
KDSAAAAGDF AGGCGKEVKL DFMFGDFMDP YLGGGGDLAR FAHADSVVPN NNNGSVGAGA  180
VELGFAVAGG AKPSYSSYTA ASMGNSGSSS EVGLVPDAIC GGGIIELDFA QSKAAFLPYA  240
STPSHSVSTM DVAVAPEISS GGVYPPPPAA GEGRAARLMR YREKRKNRRF EKTIRYASRK  300
AYAETRPRVK GRFAKRADDD DPSPADAAAP PQRVMLDFAA GYGVVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623284.11e-147PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0D9VCW40.0A0A0D9VCW4_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g08150.11e-147(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.15e-31CONSTANS-like 2